TSSK3, Mouse, Polyclonal Antibody, Abnova™

(0 customer reviews)
Availablity: In stock
Catalog/Part Number: 16180407
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16180407

₦378,810.00

Sorry no inventory found for this brand at this time.

Description

Sequence: MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESR


Catalog/Part Number: 16180407 Category:

Technical Specifications

Antigen:  TSSK3

Conjugate:  Unconjugated

Formulation:  50% glycerol

Gene Accession No.:  BC035354

Gene Alias:  SPOGA3|STK22C|STK22D

Host Species:   Mouse

Quantity:   50 uL

Storage Requirements:  Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:  Polyclonal

Target Species:  Human

Applications:   ELISA, Western Blot

Description:   Mouse polyclonal antibody raised against a partial recombinant TSSK3.

Gene:   TSSK3

Format:   Antisera

Gene Symbols:   TSSK3

Immunogen:   TSSK3 (AAH35354, 1 a.a. ∽ 110 a.a) partial recombinant protein with GST tag.

Regulatory Status:  RUO

Primary or Secondary:  Primary

Gene ID (Entrez):   81629

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews

Related Products