CLCA2, Mouse, Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16121086
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16121086

₦492,660.00

Sorry no inventory found for this brand at this time.

Description

Sequence: PTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGF

Catalog/Part Number: 16121086 Category:

Technical Specifications

Antigen:   CLCA2

Conjugate:   Unconjugated

Formulation:    50% glycerol

Gene Accession No.:   NM_006536

Gene Alias:    CACC|CACC3|CLCRG2|CaCC-3|FLJ97885

Host Species:     Mouse

Quantity:    50 uL

Storage Requirements:     Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:     Polyclonal

Target Species:    Human

Applications:    ELISA, Western Blot

Description:     Mouse polyclonal antibody raised against a partial recombinant CLCA2.

Gene:      CLCA2

Format:     Antisera

Gene Symbols:    CLCA2

Immunogen:     CLCA2 (NP_006527, 300 a.a. to 400 a.a) partial recombinant protein with GST tag.

Regulatory Status:     RUO

Primary or Secondary:    Primary

Gene ID (Entrez):   9635

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews